Examples¶
One worked example per capability, in curl and Python. All of them are the same async flow: submit, poll, download. Parameter detail lives on the endpoint pages (Predictions, Designs, Embeddings).
Fold a protein¶
BASE=https://api.japanfold.aiand.com
JOB=$(curl -s -X POST $BASE/v1/predictions \
-H 'Content-Type: application/json' \
-d '{"model":"boltz2","name":"myprotein","sequence":"MKTAYIAKQRQISFVKSHFSRQLEERLGLIEVQ"}' \
| python3 -c 'import sys,json; print(json.load(sys.stdin)["id"])')
# poll (Prefer: wait blocks up to 60s per call)
until curl -s -H 'Prefer: wait=60' $BASE/v1/jobs/$JOB \
| grep -qE '"status":"(succeeded|failed|canceled)"'; do :; done
curl -s $BASE/v1/jobs/$JOB/results
curl -s $BASE/v1/jobs/$JOB/archive -o myprotein.zip && unzip -oq myprotein.zip -d myprotein
The same thing in Python, stdlib only:
import json, time, urllib.request
BASE = "https://api.japanfold.aiand.com"
# The edge blocks urllib's default User-Agent as a bot, so send a browser-like one.
HEADERS = {"Content-Type": "application/json", "User-Agent": "Mozilla/5.0"}
def api(method, path, body=None):
data = json.dumps(body).encode() if body is not None else None
req = urllib.request.Request(BASE + path, data=data, method=method, headers=HEADERS)
with urllib.request.urlopen(req) as r:
return json.load(r)
def wait(job_id):
while True:
job = api("GET", f"/v1/jobs/{job_id}")
if job["status"] in ("succeeded", "failed", "canceled"):
return job
time.sleep(5)
job = api("POST", "/v1/predictions",
{"model": "boltz2", "name": "myprotein",
"sequence": "MKTAYIAKQRQISFVKSHFSRQLEERLGLIEVQ"})
job = wait(job["id"])
assert job["status"] == "succeeded", job.get("error")
results = api("GET", f"/v1/jobs/{job['id']}/results")
for row in results["rows"]:
print(row["id"], "plddt=", row.get("plddt"), "ptm=", row.get("ptm"))
# urlretrieve takes no headers, so open the archive directly
req = urllib.request.Request(BASE + results["archive_url"], headers=HEADERS)
with urllib.request.urlopen(req) as r, open("myprotein.zip", "wb") as f:
f.write(r.read())
Co-fold a protein + ligand, with affinity¶
Only Boltz-2 does affinity. Pass the complex as a Boltz YAML input with a
ligand chain and a properties: affinity block naming the binder.
import time, httpx
BASE = "https://api.japanfold.aiand.com"
YAML = (
"sequences:\n"
" - protein: {id: A, sequence: MKTAYIAKQRQISFVKSHFSRQLEERLGLIEVQ}\n"
" - ligand: {id: L, smiles: \"CC(=O)Oc1ccccc1C(=O)O\"}\n"
"properties:\n"
" - affinity: {binder: L}\n"
)
with httpx.Client(base_url=BASE, timeout=180) as c:
job = c.post("/v1/predictions", json={
"model": "boltz2", "name": "prot-ligand",
"input": YAML, "params": {"use_msa_server": True}}).json()
while job["status"] not in ("succeeded", "failed", "canceled"):
time.sleep(5)
job = c.get(f"/v1/jobs/{job['id']}").json()
print(c.get(f"/v1/jobs/{job['id']}/results").json()["rows"])
The result rows carry affinity fields alongside the structure and confidence
scores.
Design binders (BoltzGen)¶
POST /v1/designs with a protocol and a YAML spec. Results carry ranked
designs.
import time, httpx
BASE = "https://api.japanfold.aiand.com"
with httpx.Client(base_url=BASE, timeout=300) as c:
job = c.post("/v1/designs", json={
"protocol": "nanobody-anything", "name": "my-nanobodies",
"spec": "sequences:\n - protein: {id: A, sequence: MKTAYIAKQRQISFVKSHFSRQLEERLGLIEVQ}\n",
"params": {"num_designs": 10, "budget": 10, "fast": True}}).json()
while job["status"] not in ("succeeded", "failed", "canceled"):
time.sleep(10)
job = c.get(f"/v1/jobs/{job['id']}").json()
results = c.get(f"/v1/jobs/{job['id']}/results").json()
print(results.get("designs"))
with open("designs.zip", "wb") as f:
f.write(c.get(results["archive_url"]).content)
Design against a structure (RFdiffusion3)¶
Same endpoint, but the input is a pasted structure plus a contig saying what
stays fixed and what gets designed. Results are unranked mmCIFs.
import time, httpx
BASE = "https://api.japanfold.aiand.com"
structure = open("target.pdb").read() # chain A holds the target
with httpx.Client(base_url=BASE, timeout=300) as c:
job = c.post("/v1/designs", json={
"protocol": "rfd3-binder", "name": "my-rfd3-binders",
"structure": structure,
"contig": "A1-150,60-80", # keep target residues 1-150, design a 60-80 aa binder
"params": {"num_designs": 4, "num_timesteps": 100}}).json()
while job["status"] not in ("succeeded", "failed", "canceled"):
time.sleep(10)
job = c.get(f"/v1/jobs/{job['id']}").json()
results = c.get(f"/v1/jobs/{job['id']}/results").json()
print([d["id"] for d in results.get("designs", [])])
with open("designs.zip", "wb") as f:
f.write(c.get(results["archive_url"]).content)
Embed sequences¶
See Embeddings for the ESMC/SaProt example.